PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009109761.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 418aa    MW: 46245.5 Da    PI: 5.6145
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009109761.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.83.4e-06739335
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                       C+ ++e  + lfC+ +   lC  C  + H 
  XP_009109761.1  7 RVPCDFCNERAAVLFCRADAAKLCLPCDRHVHT 39
                    678******99******************9994 PP

2zf-B_box21.93.6e-075081334
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                     ++C+++++++++  C++++  lC++C    H
  XP_009109761.1 50 SQICDNCGSEPVSVRCFTDSLVLCQECDWDVH 81
                    689************************97777 PP

3CCT66.95.4e-23370413144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R++a++RYkeKrktR+++K+irYesRKa+A++R RvKGrFvk++
  XP_009109761.1 370 RDNAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVKGRFVKAT 413
                     899***************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.513552IPR000315B-box-type zinc finger
SMARTSM003364.0E-12552IPR000315B-box-type zinc finger
CDDcd000211.61E-8852No hitNo description
CDDcd000212.06E-85281No hitNo description
SMARTSM003360.975395IPR000315B-box-type zinc finger
PfamPF062032.1E-17370412IPR010402CCT domain
PROSITE profilePS5101715.11370412IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MSSSSERVPC DFCNERAAVL FCRADAAKLC LPCDRHVHTA NLLSKKHVRS QICDNCGSEP  60
VSVRCFTDSL VLCQECDWDV HGSCSVSDAH VRSVVEGFTG CPSALELGAL WGIDLEGRKE  120
EEKQVPVTME SFGMELDSWI SGSDVLQELV VPVPKKGGSS CGRYKQVLGK QLEELLRSGG  180
GGVDDGECDG EAGEEGNMVP EMQERLGWRR DEEEISGGGE VNQQPQTTSF TALLWNAANT  240
SDGQRQSTQI WDFNLGKSRE PEDSSRMKAA YVTNDAASFK INSFVEVKKN DTCSTKAKGV  300
KEIFQDDYNQ STSGQVLTCE SNNLPITFGS EKGSNSSSEL NFTENIGGTS CKSTRRVATK  360
ADLERLAQNR DNAMQRYKEK RKTRRYDKTI RYESRKARAD TRLRVKGRFV KATEAPYP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.57110.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1891940.0AC189194.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB003O07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109761.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 15
SwissprotQ9C7E80.0COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15
TrEMBLM4D3550.0M4D355_BRARP; Uncharacterized protein
STRINGBra010908.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28050.10.0B-box type zinc finger protein with CCT domain